PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00028.1.g03570.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 813aa    MW: 88316.6 Da    PI: 7.0328
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00028.1.g03570.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS409.82.5e-1254488082374
                          GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn.sseelaal 81 
                                    +lLl+ Ae v++++l  a+++L ++ ela+p g+++qR+aayf+eA++arl++s+ +ly+ lp+++ +     s++++a+
  Zjn_sc00028.1.g03570.1.am.mk 448 LTLLLQSAESVNADNLDDAHQTLLEIAELATPFGTSTQRVAAYFAEAMSARLVSSCLGLYAPLPATSPAAALlNSRVATAF 528
                                   579************************************************************8777776656899999** PP

                          GRAS  82 klfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetg 162
                                   ++f+ +sP++kfsh+taNqaI ea+e+e+rvHiiD+di+qGlQWp L++ LasRp+gpp++++Tg+gs    s e le+tg
  Zjn_sc00028.1.g03570.1.am.mk 529 QVFNGISPFVKFSHFTANQAIQEAFEREDRVHIIDLDIMQGLQWPGLFHILASRPGGPPRVKLTGLGS----SMEVLEATG 605
                                   ********************************************************************....********* PP

                          GRAS 163 erLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvve 243
                                   +rL++fA++lg+pf+f + va++  ++++e+L v ++Ea+aV++ +  h+l+d ++s ++    +L+l+++l Pkvv++ve
  Zjn_sc00028.1.g03570.1.am.mk 606 KRLSDFADTLGLPFQFCA-VAEKAGNVDPEKLGVTRREAVAVHWLH--HSLYDVTGSDSN----TLWLIQRLAPKVVTMVE 679
                                   ******************.7*************************9..999999999999....***************** PP

                          GRAS 244 qeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGF 324
                                   q+++h s+sFl+rf+ea++yysalfdsl+a+++++s er++vE++ll+rei+nv+a  g +r  + + +++Wre+l+++GF
  Zjn_sc00028.1.g03570.1.am.mk 680 QDLSH-SGSFLARFVEAIHYYSALFDSLDASYGEDSPERHVVEQQLLSREIRNVLAVGGPARSGDVK-FGSWREKLGQSGF 758
                                   *****.899****************************************************988887.************* PP

                          GRAS 325 kpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                   ++++l  +aa+qa+lll +++sdgy++ ee+g+l lgWkd  L+++SaWr
  Zjn_sc00028.1.g03570.1.am.mk 759 RAASLAGSAAAQASLLLGMFPSDGYTLVEENGALKLGWKDLCLLTASAWR 808
                                   *************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512575130No hitNo description
PROSITE profilePS5098561.43421788IPR005202Transcription factor GRAS
PfamPF035148.8E-123448808IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008356Biological Processasymmetric cell division
GO:0009630Biological Processgravitropism
GO:0009956Biological Processradial pattern formation
GO:0048366Biological Processleaf development
GO:0051457Biological Processmaintenance of protein location in nucleus
GO:0090610Biological Processbundle sheath cell fate specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 813 aa     Download sequence    Send to blast
MSEYPWRFEP LFARHIRRRS TWILPSFISC EEYHRPSDPF IVPCSSSHSS QTNGLTFKKE  60
ACAAALSGRR GEARVTVWLG YRTKQQQQQQ LRDQGPARTP QFATPIHLAR SRAHSVADRR  120
RQPLQNETIV DHESPRAREL KVNSYKEGIF CLARSPFFFP WEWENGNEAT PPHTQMGSSS  180
LLLFPSSASA ASRAYSSAHA TATSTLSSSH SLLPPLPSPS SYSQQDPHRL DGHQQEQVAM  240
VRKRPAPDMD LPPPRRHVTG DLSDVTAAAA AAQLPALPTQ LHLPAFQQHG GEVDVAPPQV  300
QPGEVTTAWV DGIIRDIIGS SGPANVREII HPCNPGLASV LELRLRSLLA AADPALPPPH  360
QHPGLVHHHT AAPGAAALPP PQSLPDKRRH EAPPPPCQEE QPQSPKAPSA EETAAAAAAA  420
AAAAAAAAKE RKEEQRRKQR DEEGLHLLTL LLQSAESVNA DNLDDAHQTL LEIAELATPF  480
GTSTQRVAAY FAEAMSARLV SSCLGLYAPL PATSPAAALL NSRVATAFQV FNGISPFVKF  540
SHFTANQAIQ EAFEREDRVH IIDLDIMQGL QWPGLFHILA SRPGGPPRVK LTGLGSSMEV  600
LEATGKRLSD FADTLGLPFQ FCAVAEKAGN VDPEKLGVTR REAVAVHWLH HSLYDVTGSD  660
SNTLWLIQRL APKVVTMVEQ DLSHSGSFLA RFVEAIHYYS ALFDSLDASY GEDSPERHVV  720
EQQLLSREIR NVLAVGGPAR SGDVKFGSWR EKLGQSGFRA ASLAGSAAAQ ASLLLGMFPS  780
DGYTLVEENG ALKLGWKDLC LLTASAWRPI QAA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-5147780833375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0636820.0BT063682.1 Zea mays full-length cDNA clone ZM_BFc0094J16 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004977413.10.0PREDICTED: protein SCARECROW 1-like
SwissprotA2ZHL00.0SCR2_ORYSI; Protein SCARECROW 2
SwissprotQ2QYF30.0SCR2_ORYSJ; Protein SCARECROW 2
TrEMBLA0A0E0RD240.0A0A0E0RD24_ORYRU; Uncharacterized protein
STRINGLOC_Os12g02870.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137138122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.10.0GRAS family protein